PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G112300.1
Common NameB456_009G112300, LOC105767492
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 322aa    MW: 36232.1 Da    PI: 9.3693
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G112300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.98.5e-3252105255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         prlrWtpeLH +Fv+ave+LGG+e+AtPk +l+lm+++gL+++hvkSHLQ+YR+
  Gorai.009G112300.1  52 PRLRWTPELHLCFVRAVERLGGQERATPKLVLQLMNIEGLSIAHVKSHLQMYRS 105
                         8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.91648108IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-2948106IPR009057Homeodomain-like
SuperFamilySSF466892.87E-1549106IPR009057Homeodomain-like
TIGRFAMsTIGR015575.2E-2352107IPR006447Myb domain, plants
PfamPF002497.9E-1053104IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MHKINPLNLD EDEEADDGIS KTINSTASPS NSSEKKASAS SGVRPYVRSK TPRLRWTPEL  60
HLCFVRAVER LGGQERATPK LVLQLMNIEG LSIAHVKSHL QMYRSKKIDD KGQVVNNRHL  120
LGSVNYCSQN LRYQSMLQDQ RVISDISWSA FAGNRINCRR RAGFCRSDMT KEVGSKARNE  180
VFYMNNNPIF SQQPVREIEG FQDIIDDCAE VQPILILPSF PNKWPGRGAE RQVRVAKRKA  240
VDDEDLDLSL SLSTKMGQEV RRKTCNEEEA ANSNLSLSLS SPSKTEMYSL NVNMVSKRSN  300
LKEGHDSTRY LKLASTLDLT I*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012442497.10.0PREDICTED: uncharacterized protein LOC105767492 isoform X2
TrEMBLA0A0D2UK020.0A0A0D2UK02_G
STRINGPOPTR_0001s28690.15e-56(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36328184
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.11e-40G2-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]